PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_56103.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 147aa    MW: 17339.7 Da    PI: 9.265
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_56103.4genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.45.5e-5771361129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                   +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL++  k+   e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++
  MLOC_56103.4   7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQEkcKIGMeEQNDWYFFSHKDKKYPTGTRTNRATSAGFWKATGRDKPIYT 102
                   69****************************.9***************952433333556************************************** PP

           NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    ++ lvg++ktLvfykgrap+g+k+dW+mheyrle
  MLOC_56103.4 103 -NHCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                   .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-585142IPR003441NAC domain
PROSITE profilePS5100555.2467147IPR003441NAC domain
PfamPF023651.3E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MDTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQEKCKIGM  60
EEQNDWYFFS HKDKKYPTGT RTNRATSAGF WKATGRDKPI YTNHCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GATPVRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-51613514140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934241e-146JQ693424.1 Brachypodium distachyon SWN3 (SWN3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266811.11e-101uncharacterized protein LOC100832773
RefseqXP_010233638.11e-101PREDICTED: uncharacterized protein LOC100832773 isoform X1
SwissprotQ9FWX22e-93NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM0X0R21e-109M0X0R2_HORVD; Uncharacterized protein
STRINGMLOC_56103.11e-105(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.14e-83NAC 007